PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G11750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 449aa    MW: 48072.7 Da    PI: 5.0861
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G11750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.6e-081859338
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                     +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  OMERI06G11750.1 18 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 59
                     578*****************************6567777776 PP

2CCT67.34.1e-23392435144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  OMERI06G11750.1 392 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 435
                      9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.2E-111663IPR000315B-box-type zinc finger
PROSITE profilePS5011910.481663IPR000315B-box-type zinc finger
PfamPF006431.3E-61960IPR000315B-box-type zinc finger
CDDcd000212.46E-82163No hitNo description
PfamPF062037.6E-18392434IPR010402CCT domain
PROSITE profilePS5101716.083392434IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSCTAKAAAA GAVGAKAARA CDGCLRRRAR WYCAADDAFL CQGCDTSVHS ANPLARRHER  60
LRLRPSSPPP LVPPSGSGRR DKAVPAAWFK RKARTPRSHA AKSAAAVGQL LSRRLVVVPE  120
AAAGSGGDSP EERKDEGEIV EEQLLYRVPI FDPALSEFCS PPPLEDAAAA VSCCNEDGAV  180
ENPTKPSMTT TTATTPPLQF FPDGHANFGP TDAELREFAA DMEALLGRGL DDGNDEDSFC  240
METLGLIEPV DDDTGRVKVE ADGDAGMTLA WCHELDTETS SGEMLDIDFD CGSPQAATTP  300
DEKVGSSGPG AAAADDDDSQ LQQSSLALSL NYEAIIESWG TSPWTDGERP RVKLDDSWPR  360
DYSGVWMAAA GVFGHGGEEQ ALTPRLGMDG GREARVSRYR EKRRTRLFSK KIRYEVRKLN  420
AEKRPRMKGR FVKRAAAAAA ATVATACVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1402418RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412490.0AK241249.1 Oryza sativa Japonica Group cDNA, clone: J065129J23, full insert sequence.
GenBankAK2878360.0AK287836.1 Oryza sativa Japonica Group cDNA, clone: J065191O19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641417.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0E0E0730.0A0A0E0E073_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g15330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-61B-box type zinc finger protein with CCT domain